PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016491349.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 755aa    MW: 84343.5 Da    PI: 4.5336
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016491349.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding409.4e-13603644346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rW+++E el+++av+q+G++  ++I + ++ gRt+ q+k+++ k
   XP_016491349.1 603 RWSKQETELFYEAVQQFGTD-LSLIQQLFP-GRTRRQLKLKYKK 644
                      9*******************.*********.***********87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF159631.1E-28594678No hitNo description
PROSITE profilePS5129311.203599647IPR017884SANT domain
SMARTSM007173.1E-10600648IPR001005SANT/Myb domain
SuperFamilySSF466898.97E-11602651IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.7E-8603644IPR009057Homeodomain-like
CDDcd001673.55E-8603644No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 755 aa     Download sequence    Send to blast
MCIWIWFLKN LVLMWNTKQR SYSLLINLSM DLLDDILADG ASKTVKAGGK FQPKAKPRPV  60
KKGPAVASST VSLTSKPTGD TVATDSFEAL KKDGKNSQNY YEQSSVLAEP SLEHPLAAET  120
LCPSVGSYLD TSTVVPDNSE DSKTCLEKSE GEYADIYIGL DSFDDLLPTS SAIENSSPAT  180
DPSAVHVDGA EKGQDQLSIP VSSVDDSAPS TSNLQPDEVA GCQDPLTCQG SVVPVSGSCQ  240
MEMDSYPSLE ADILGVTTTS GQSTRRFQPK SKLQVYRERY DTSIPDSDAV ESVSCQPNSH  300
SVHSEMDFVD RGKEHGFPAD DVLDFSARGF DNNIITESTH EFPVHEEYVI EASHSDVRIP  360
AELHESTSQM PEEPVHQRPK TKKQKLPASD LSAITEENGA GRSLRSRRKS VNANRLVDES  420
EVVADDGEYV PEQPNDSVTN GNNEDLLVEN ESQGKKVQKK SKRTVAEDGK QVRKSKKTTE  480
ASDQAANKKP KKFSHSTRQK RRQVNKALLE APEYEIDYQK VPIKDLIILG EHRERLAKKD  540
AAASQIPTTD QSTGASVSNY NEDETYPSDD GAEDNDHQIG SRAQDSSAYF NYQTYMDKTP  600
STRWSKQETE LFYEAVQQFG TDLSLIQQLF PGRTRRQLKL KYKKEERQHP FRLHDALTNR  660
SKDHSHFERV IERLKQIEAE ELQKADKDES IDLTGEQEVE EGTQEINEEE ANSENVEKKE  720
VEAVEQQDVP EMESPIEDYD SEDDSWRWSQ YKSEV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU0488873e-94GU048887.1 Capsicum annuum clone BAC CaCM511O09_Contig, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016491349.10.0PREDICTED: uncharacterized protein LOC107811026 isoform X1
TrEMBLM1BI380.0M1BI38_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000457280.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA59022326
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.16e-50MYB_related family protein